PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013616162.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 338aa    MW: 37729.8 Da    PI: 4.9742
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013616162.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++q+G+g+W++++   g+ R+ k+c++rw +yl
   XP_013616162.1 14 KGPWTPEEDIILVSYIQQHGPGNWRSVPLNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding43.47.8e-1467109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg++T+ E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+
   XP_013616162.1  67 RGNFTQPEEKTIIRLQALLGNR-WAAIASYLP-QRTDNDIKNYWN 109
                      89********************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.012965IPR017930Myb domain
SuperFamilySSF466894.4E-3011108IPR009057Homeodomain-like
SMARTSM007174.7E-141363IPR001005SANT/Myb domain
PfamPF002491.0E-151461IPR001005SANT/Myb domain
CDDcd001672.71E-111661No hitNo description
Gene3DG3DSA:1.10.10.603.2E-2365116IPR009057Homeodomain-like
SMARTSM007171.6E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129418.39166116IPR017930Myb domain
PfamPF002496.9E-1367109IPR001005SANT/Myb domain
CDDcd001671.77E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MGRPPCCGKM EVKKGPWTPE EDIILVSYIQ QHGPGNWRSV PLNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TQPEEKTIIR LQALLGNRWA AIASYLPQRT DNDIKNYWNI HLKKKLELKV  120
QNGITNEDNT DMTEIPSCNI HNNSCNNNNN KRVVNKGQWE KKLQTDINMA KQALLQALSL  180
DQPSSSIPPD PDSSETHHSA TSTYASSTDN IFKLLQNWTS SSSSIPNTSS HSMNRGLSTG  240
EVGVLDHQSL FSSHSESGSV DGKLNLMTET SMFKDGSEPN GDIEATTDAT TDDHGSLSLI  300
EQWLFDEQGI CQCDGNQEDL IEVSFEGIDN DNNDQDLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-251111624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013616162.10.0PREDICTED: myb-related protein 306-like
RefseqXP_013726508.10.0PREDICTED: myb-related protein 306-like
SwissprotP813924e-95MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0D3AQJ20.0A0A0D3AQJ2_BRAOL; Uncharacterized protein (Fragment)
STRINGBra008160.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74650.11e-136myb domain protein 31